PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0177s0310.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 414aa    MW: 46479.9 Da    PI: 9.503
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0177s0310.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.18.6e-25155198144
                     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                             d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg+srsrk++e
  SapurV1A.0177s0310.1.p 155 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKSRSRKPVE 198
                             79***************************************986 PP

2QLQ59.41.1e-2090124236
                     QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                             +FT +Q+q+L++Q+l+yKy+++++PvPpeLl a++
  SapurV1A.0177s0310.1.p  90 PFTSTQWQELEHQALIYKYMVSGVPVPPELLYAVK 124
                             8******************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.8E-1289125IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.91490125IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088808.8E-1690123IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.941155199IPR014977WRC domain
PfamPF088792.7E-20156198IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MLMDLCKDVR DKNSSGSRSR SRSRSRRGAV IIRADSLSTS GREEVAAGLC ITAISFSIHS  60
QKKILQAIES EKIPFKTISP TRAITRNRFP FTSTQWQELE HQALIYKYMV SGVPVPPELL  120
YAVKRSLESS LASRLFPHQP SGWGCFQAGF GRKADPEPGR CRRTDGKKWR CSKEAYPDSK  180
YCERHMHRGK SRSRKPVELA SSTPTTTATI PLINRNLSNP TVSPSSSSYS FSHPSSSAES  240
EVYAHQNSSH RTFLYPHSSS SGPPESVFYP QNSTPHNLFL EPGSSPHADK QHRHYHGMRE  300
DVDERAFFPD GLVRARGVQD SYNQLPMSSY KGYSLPQFQT FADTSKEEQP QPGQHCFVLG  360
TDIIKSSATR SIKLEKETET LKPLHHFFDQ WEPKDADSWL DLASSSRPHT ADD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11725RSRSRSRSR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2175881e-103AC217588.1 Populus trichocarpa clone POP047-P10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011035717.10.0PREDICTED: growth-regulating factor 5-like
TrEMBLB9GKU60.0B9GKU6_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0001s16920.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF97443137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.13e-63growth-regulating factor 5